ICAM2 (NM_000873) Human Recombinant Protein
CAT#: TP300459
Recombinant protein of human intercellular adhesion molecule 2 (ICAM2), transcript variant 5, 20 µg
View other "ICAM2" proteins (20)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200459 protein sequence
Red=Cloning site Green=Tags(s) MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000864 |
Locus ID | 3384 |
UniProt ID | P13598, Q6FHE2 |
Refseq Size | 1229 |
Cytogenetics | 17q23.3 |
Refseq ORF | 825 |
Synonyms | CD102 |
Summary | The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420535 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420536 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420537 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420538 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424476 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426090 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426091 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420535 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 1 |
CNY 3,080.00 |
|
LY420536 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 2 |
CNY 3,080.00 |
|
LY420537 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 3 |
CNY 3,080.00 |
|
LY420538 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 4 |
CNY 3,080.00 |
|
LY424476 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 5 |
CNY 3,080.00 |
|
PH300459 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000864) |
CNY 19,520.00 |
|
PH312720 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093257) |
CNY 14,250.00 |
|
PH312775 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093259) |
CNY 14,250.00 |
|
PH316706 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093258) |
CNY 14,250.00 |
|
TP312720 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP312775 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP316706 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720626 | Purified recombinant protein of Human intercellular adhesion molecule 2 (ICAM2), transcript variant 5 |
CNY 3,140.00 |