RAB7L1 (RAB29) (NM_003929) Human Recombinant Protein
CAT#: TP300431
Recombinant protein of human RAB7, member RAS oncogene family-like 1 (RAB7L1), transcript variant 1, 20 µg
View other "RAB7L1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200431 protein sequence
Red=Cloning site Green=Tags(s) MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERF TSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQID RFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003920 |
Locus ID | 8934 |
UniProt ID | O14966 |
Refseq Size | 3324 |
Cytogenetics | 1q32.1 |
Refseq ORF | 609 |
Synonyms | RAB7L; RAB7L1 |
Summary | Rab GTPase key regulator in vesicle trafficking. Essential for maintaining the integrity of the endosome-trans-Golgi network structure. Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner. Regulates neuronal process morphology in the intact central nervous system (CNS). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.Typhi) epithelial cell infection.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418334 | RAB29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427656 | RAB29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418334 | Transient overexpression lysate of RAB7, member RAS oncogene family-like 1 (RAB7L1), transcript variant 1 |
CNY 3,080.00 |
|
LY427656 | Transient overexpression lysate of RAB7, member RAS oncogene family-like 1 (RAB7L1), transcript variant 2 |
CNY 3,080.00 |
|
PH300431 | RAB7L1 MS Standard C13 and N15-labeled recombinant protein (NP_003920) |
CNY 19,520.00 |
|
PH327093 | RAB7L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129134) |
CNY 19,520.00 |
|
TP327093 | Recombinant protein of human RAB7, member RAS oncogene family-like 1 (RAB7L1), transcript variant 2, 20 µg |
CNY 2,900.00 |