SYK (NM_003177) Human Recombinant Protein
CAT#: TP300413
Recombinant protein of human spleen tyrosine kinase (SYK), transcript variant 1, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200413 representing NM_003177
Red=Cloning site Green=Tags(s) MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIEREL NGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQG QALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHE GKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSH PATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYES PYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNF VHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGV LMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYY YDVVN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 71.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003168 |
Locus ID | 6850 |
UniProt ID | P43405 |
Refseq Size | 2672 |
Cytogenetics | 9q22.2 |
Refseq ORF | 1905 |
Synonyms | IMD82; p72-Syk |
Summary | This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. It is thought to be a modulator of epithelial cell growth and a potential tumour suppressor in human breast carcinomas. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Natural killer cell mediated cytotoxicity |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Interplay between HGAL and Grb2 proteins regulates B-cell receptor signaling
,Jiang, X;Lu, X;Zhang, Y;Lacaria, L;Schuchardt, BJ;Mikles, DC;Magistri, M;García-Ramírez, I;Sanchez-Garcia, I;Farooq, A;Verdun, RE;Abdulreda, MH;Moy, VT;Lossos, IS;,
Blood Adv
,PubMed ID 31362927
[SYK]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401101 | SYK HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401101 | Transient overexpression lysate of spleen tyrosine kinase (SYK), transcript variant 1 |
CN¥ 3,080.00 |
|
PH300413 | SYK MS Standard C13 and N15-labeled recombinant protein (NP_003168) |
CN¥ 19,520.00 |