SGT1 (ECD) (NM_007265) Human Recombinant Protein
CAT#: TP300384
Recombinant protein of human ecdysoneless homolog (Drosophila) (ECD), transcript variant 1, 20 µg
View other "SGT1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200384 protein sequence
Red=Cloning site Green=Tags(s) MEETMKLATMEDTVEYCLFLIPDESRDSDKHKEILQKYIERIITRFAPMLVPYIWQNQPFNLKYKPGKGG VPAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEAADFLPKWLDPENSTNRVFF CHGELCIIPAPRKSGAESWLPTTPPTIPQALNIITAHSEKILASESIRAAVNRRIRGYPEKIQASLHRAH CFLPAGIVAVLKQRPRLVAAAVQAFYLRDPIDLRACRVFKTFLPETRIMTSVTFTKCLYAQLVQQRFVPD RRSGYRLPPPSDPQYRAHELGMKLAHGFEILCSKCSPHFSDCKKSLVTASPLWASFLESLKKNDYFKGLI EGSAQYRERLEMAENYFQLSVDWPESSLAMSPGEEILTLLQTIPFDIEDLKKEAANLPPEDDDQWLDLSP DQLDQLLQEAVGKKESESVSKEEKEQNYDLTEVSESMKAFISKVSTHKGAELPREPSEAPITFDADSFLN YFDKILGPRPNESDSDDLDDEDFECLDSDDDLDFETHEPGEEASLKGTLDNLKSYMAQMDQELAHTCISK SFTTRNQVEPVSQTTDNNSDEEDSGTGESVMAPVDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLP DNTDHRPTSKPTKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 72.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009196 |
Locus ID | 11319 |
UniProt ID | O95905 |
Refseq Size | 2280 |
Cytogenetics | 10q22.2 |
Refseq ORF | 1932 |
Synonyms | GCR2; HSGT1; SGT1 |
Summary | Regulator of p53/TP53 stability and function. Inhibits MDM2-mediated degradation of p53/TP53 possibly by cooperating in part with TXNIP (PubMed:16849563, PubMed:23880345). May be involved transcriptional regulation. In vitro has intrinsic transactivation activity enhanced by EP300. May be a transcriptional activator required for the expression of glycolytic genes (PubMed:19919181, PubMed:9928932). Involved in regulation of cell cycle progression. Proposed to disrupt Rb-E2F binding leading to transcriptional activation of E2F proteins (PubMed:19640839). The cell cycle -regulating function may depend on its RUVBL1-mediated association with the R2TP complex (PubMed:26711270). May play a role in regulation of pre-mRNA splicing (PubMed:24722212).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416084 | ECD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427697 | ECD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416084 | Transient overexpression lysate of ecdysoneless homolog (Drosophila) (ECD), transcript variant 1 |
CNY 3,080.00 |
|
LY427697 | Transient overexpression lysate of ecdysoneless homolog (Drosophila) (ECD), transcript variant 2 |
CNY 4,840.00 |
|
PH300384 | ECD MS Standard C13 and N15-labeled recombinant protein (NP_009196) |
CNY 19,520.00 |
|
TP762522 | Purified recombinant protein of Human ecdysoneless homolog (Drosophila) (ECD), transcript variant 1, full length, 50ug |
CNY 2,480.00 |