SGT1 (ECD) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ECD antibody: synthetic peptide directed towards the middle region of human ECD. Synthetic peptide located within the following region: VDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	ecdysoneless cell cycle regulator
Database Link	NP_009196 Entrez Gene 11319 Human UniProt ID O95905
Background	The exact function of ECD remains unknown.
Synonyms	GCR2; HSGT1; SGT1
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Goat: 79%; Rat: 77%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.