DDX5 (NM_004396) Human Recombinant Protein
CAT#: TP300371
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 20 µg
View other "DDX5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 4 publications. |
CN¥ 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200371 protein sequence
Red=Cloning site Green=Tags(s) MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTA QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQT GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQ IRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA TWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVET KRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMK DDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRT GNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Phosphorylation substrate (PMID: 25649741) Binding assay (PMID: 27148684) |
Reference Data | |
RefSeq | NP_004387 |
Locus ID | 1655 |
UniProt ID | P17844 |
Refseq Size | 3769 |
Cytogenetics | 17q23.3 |
Refseq ORF | 1842 |
Synonyms | G17P1; HLR1; HUMP68; p68 |
Summary | This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2017] |
Protein Pathways | Spliceosome |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
DDX5-targeting fully human monoclonal autoantibody inhibits proliferation and promotes differentiation of acute promyelocytic leukemia cells by increasing ROS production
,Wu, J;You, YQ;Ma, YX;Kang, YH;Wu, T;Wu, XJ;Hu, XX;Meng, QH;Huang, Y;Zhang, N;Pan, XB;,
Cell Death Dis
,PubMed ID 32690860
[DDX5]
|
ATAD5 restricts R-loop formation through PCNA unloading and RNA helicase maintenance at the replication fork
,Kim, S;Kang, N;Park, SH;Wells, J;Hwang, T;Ryu, E;Kim, BG;Hwang, S;Kim, SJ;Kang, S;Lee, S;Stirling, P;Myung, K;Lee, KY;,
Nucleic Acids Res.
,PubMed ID 32542338
[DDX5]
|
Resveratrol directly targets DDX5 resulting in suppression of the mTORC1 pathway in prostate cancer
,Taniguchi, T;Iizumi, Y;Watanabe, M;Masuda, M;Morita, M;Aono, Y;Toriyama, S;Oishi, M;Goi, W;Sakai, T;,
Cell Death Dis
,PubMed ID 27148684
[DDX5]
|
A Novel Anti-Cancer Agent, 1-(3, 5-Dimethoxyphenyl)-4-[(6-fluoro-2-methoxyquinoxalin-3-yl)aminocarbonyl] piperazine (RX-5902),Interferes with ß-Catenin Function through Y593 phospho-p68RNA Helicase
,Kost, GC;Yang, MY;Li, L;Zhang, Y;Liu, CY;Kim, DJ;Ahn, CH;Lee, YB;Liu, ZR;,
J. Cell. Biochem.
,PubMed ID 25649741
[DDX5]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401398 | DDX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401398 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5) |
CN¥ 3,080.00 |
|
PH300371 | DDX5 MS Standard C13 and N15-labeled recombinant protein (NP_004387) |
CN¥ 19,520.00 |