elF2 alpha (EIF2S1) (NM_004094) Human Recombinant Protein
CAT#: TP300368
Recombinant protein of human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), 20 µg
View other "elF2 alpha" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200368 protein sequence
Red=Cloning site Green=Tags(s) MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD TDETELARQMERLERENAEVDGDDDAEEMEAKAED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004085 |
Locus ID | 1965 |
UniProt ID | P05198 |
Refseq Size | 4165 |
Cytogenetics | 14q23.3 |
Refseq ORF | 945 |
Synonyms | EIF-2; EIF-2A; EIF-2alpha; EIF2; EIF2A |
Summary | The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is composed of 3 nonidentical subunits, the 36-kD EIF2-alpha subunit (EIF2S1), the 38-kD EIF2-beta subunit (EIF2S2; MIM 603908), and the 52-kD EIF2-gamma subunit (EIF2S3; MIM 300161). The rate of formation of the ternary complex is modulated by the phosphorylation state of EIF2-alpha (Ernst et al., 1987 [PubMed 2948954]).[supplied by OMIM, Feb 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401321 | EIF2S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401321 | Transient overexpression lysate of eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1) |
CN¥ 3,080.00 |
|
PH300368 | EIF2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004085) |
CN¥ 19,520.00 |
其它elF2 alpha产品