glutathione S transferase Omega 1 (GSTO1) (NM_004832) Human Recombinant Protein
CAT#: TP300362
Recombinant protein of human glutathione S-transferase omega 1 (GSTO1), 20 µg
View other "glutathione S transferase Omega 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200362 protein sequence
Red=Cloning site Green=Tags(s) MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFG LVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYA GLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDP TVSALLTSEKDWQGFLELYLQNSPEACDYGL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 27.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004823 |
Locus ID | 9446 |
UniProt ID | P78417, V9HWG9 |
Refseq Size | 1017 |
Cytogenetics | 10q25.1 |
Refseq ORF | 723 |
Synonyms | GSTO 1-1; GSTTLp28; HEL-S-21; P28; SPG-R |
Summary | The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417720 | GSTO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434052 | GSTO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417720 | Transient overexpression lysate of glutathione S-transferase omega 1 (GSTO1) |
CNY 3,080.00 |
|
LY434052 | Transient overexpression lysate of glutathione S-transferase omega 1 (GSTO1), transcript variant 2 |
CNY 3,080.00 |
|
PH300362 | GSTO1 MS Standard C13 and N15-labeled recombinant protein (NP_004823) |
CNY 19,520.00 |
其它glutathione S transferase Omega 1产品