glutathione S transferase Omega 1 (GSTO1) (NM_004832) Human Mass Spec Standard
CAT#: PH300362
GSTO1 MS Standard C13 and N15-labeled recombinant protein (NP_004823)
View other "glutathione S transferase Omega 1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GSTO1 MS Standard C13 and N15-labeled recombinant protein (NP_004823) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200362 |
Predicted MW | 27.6 kDa |
Protein Sequence |
>RC200362 protein sequence
Red=Cloning site Green=Tags(s) MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFG LVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYA GLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDP TVSALLTSEKDWQGFLELYLQNSPEACDYGL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004823 |
RefSeq Size | 1017 |
RefSeq ORF | 723 |
Synonyms | GSTO 1-1; GSTTLp28; HEL-S-21; P28; SPG-R |
Locus ID | 9446 |
Cytogenetics | 10q25.1 |
Summary | The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417720 | GSTO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434052 | GSTO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417720 | Transient overexpression lysate of glutathione S-transferase omega 1 (GSTO1) |
CNY 3,080.00 |
|
LY434052 | Transient overexpression lysate of glutathione S-transferase omega 1 (GSTO1), transcript variant 2 |
CNY 3,080.00 |
|
TP300362 | Recombinant protein of human glutathione S-transferase omega 1 (GSTO1), 20 µg |
CNY 2,900.00 |
其它glutathione S transferase Omega 1产品