CDK5 (NM_004935) Human Recombinant Protein
CAT#: TP300342
Recombinant protein of human cyclin-dependent kinase 5 (CDK5), 20 µg
View other "CDK5" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200342 protein sequence
Red=Cloning site Green=Tags(s) MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL HSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGEL KLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDD QLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEA LQHPYFSDFCPP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004926 |
Locus ID | 1020 |
UniProt ID | Q00535 |
Refseq Size | 1211 |
Cytogenetics | 7q36.1 |
Refseq ORF | 876 |
Synonyms | LIS7; PSSALRE |
Summary | This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Alzheimer's disease, Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401536 | CDK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431225 | CDK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401536 | Transient overexpression lysate of cyclin-dependent kinase 5 (CDK5), transcript variant 1 |
CNY 3,080.00 |
|
LY431225 | Transient overexpression lysate of cyclin-dependent kinase 5 (CDK5), transcript variant 2 |
CNY 3,080.00 |
|
PH300342 | CDK5 MS Standard C13 and N15-labeled recombinant protein (NP_004926) |
CNY 19,520.00 |