AKR1A1 (NM_006066) Human Recombinant Protein
CAT#: TP300302
Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1, 20 µg
View other "AKR1A1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200302 protein sequence
Red=Cloning site Green=Tags(s) MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006057 |
Locus ID | 10327 |
UniProt ID | P14550 |
Refseq Size | 1597 |
Cytogenetics | 1p34.1 |
Refseq ORF | 975 |
Synonyms | ALDR1; ALR; ARM; DD3; HEL-S-6 |
Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401826 | AKR1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407047 | AKR1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401826 | Transient overexpression lysate of aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1 |
CNY 3,080.00 |
|
LY407047 | Transient overexpression lysate of aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2 |
CNY 3,080.00 |
|
PH300302 | AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_006057) |
CNY 19,520.00 |
|
PH302813 | AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_697021) |
CNY 19,520.00 |
|
TP302813 | Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2, 20 µg |
CNY 2,900.00 |