S100 beta (S100B) (NM_006272) Human Recombinant Protein
CAT#: TP300277
Recombinant protein of human S100 calcium binding protein B (S100B), 20 µg
View other "S100 beta" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200277 protein sequence
Red=Cloning site Green=Tags(s) MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD FQEFMAFVAMVTTACHEFFEHE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006263 |
Locus ID | 6285 |
UniProt ID | P04271 |
Refseq Size | 1135 |
Cytogenetics | 21q22.3 |
Refseq ORF | 276 |
Synonyms | NEF; S100; S100-B; S100beta |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A multimodal RAGE-specific inhibitor reduces amyloid ?-mediated brain disorder in a mouse model of Alzheimer disease
,null,
The Journal of Clinical Investigation
,PubMed ID 22406537
[S100B]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416735 | S100B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416735 | Transient overexpression lysate of S100 calcium binding protein B (S100B) |
CN¥ 3,080.00 |
|
PH300277 | S100B MS Standard C13 and N15-labeled recombinant protein (NP_006263) |
CN¥ 19,520.00 |
|
TP750189 | Purified recombinant protein of Human S100 calcium binding protein B (S100B),full length, tag free, expressed in E.coli, 50ug |
CN¥ 2,840.00 |
其它S100 beta产品