14-3-3 epsilon (YWHAE) (NM_006761) Human Recombinant Protein

CAT#: TP300245

Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1, 20 µg

Size: 20 ug 100 ug 1 mg



  View other "14-3-3 epsilon" proteins (4)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00

CN¥ 6,650.00


货期*
现货

规格
    • 20 ug

Cited in 1 publication.

Product images

经常一起买 (2)
Anti-YWHAE Rabbit Polyclonal Antibody
    • 100 ul

CN¥ 1,999.00
CN¥ 3,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200245 protein sequence
Red=Cloning site Green=Tags(s)

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE
ENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGND
RKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLS
EESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Bioactivity In vitro ubiquitination assay (regulator) (PMID: 28212375)
Co-immunoprecipitation (PMID: 28212375)
Reference Data
RefSeq NP_006752
Locus ID 7531
UniProt ID P62258
Refseq Size 1827
Cytogenetics 17p13.3
Refseq ORF 765
Synonyms 14-3-3E; HEL2; KCIP-1; MDCR; MDS
Summary This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. [provided by RefSeq, Aug 2008]
Protein Families Druggable Genome
Protein Pathways Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Documents

Other Versions

Customer Reviews 
Loading...