HRASLS3 (PLA2G16) (NM_007069) Human Recombinant Protein
CAT#: TP300242
Recombinant protein of human phospholipase A2, group XVI (PLA2G16), transcript variant 1, 20 µg
View other "HRASLS3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200242 representing NM_007069
Red=Cloning site Green=Tags(s) MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA GMGLAAMSLIGVMFSRNKRQKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009000 |
Locus ID | 11145 |
UniProt ID | P53816 |
Refseq Size | 1070 |
Cytogenetics | 11q12.3-q13.1 |
Refseq ORF | 486 |
Synonyms | AdPLA; H-REV107; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3; PLA2G16; PLAAT-3 |
Summary | Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:22923616). For most substrates, PLA1 activity is much higher than PLA2 activity (PubMed:19615464). Shows O-acyltransferase activity,catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid (PubMed:19615464). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381). Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity (PubMed:22825852).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416202 | PLA2G16 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426918 | PLA2G16 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416202 | Transient overexpression lysate of phospholipase A2, group XVI (PLA2G16), transcript variant 1 |
CN¥ 3,080.00 |
|
LY426918 | Transient overexpression lysate of phospholipase A2, group XVI (PLA2G16), transcript variant 2 |
CN¥ 3,080.00 |
|
PH300242 | PLA2G16 MS Standard C13 and N15-labeled recombinant protein (NP_009000) |
CN¥ 19,520.00 |
|
PH325152 | PLA2G16 MS Standard C13 and N15-labeled recombinant protein (NP_001121675) |
CN¥ 19,520.00 |
|
TP325152 | Recombinant protein of human phospholipase A2, group XVI (PLA2G16), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
其它HRASLS3产品