Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein
CAT#: TP300241
Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), 20 µg
View other "Sumo 3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200241 protein sequence
Red=Cloning site Green=Tags(s) MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008867 |
Locus ID | 6612 |
UniProt ID | P55854 |
Refseq Size | 1831 |
Cytogenetics | 21q22.3 |
Refseq ORF | 309 |
Synonyms | SMT3A; Smt3B; SMT3H1; SUMO-3 |
Summary | This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402068 | SUMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402068 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 3,080.00 |
|
PH300241 | SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867) |
CNY 19,520.00 |
|
TP720508 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 3,140.00 |
|
TP721152 | Purified recombinant protein of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 3,140.00 |