GMPPB (NM_021971) Human Recombinant Protein
CAT#: TP300186
Recombinant protein of human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2, 20 µg
View other "GMPPB" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200186 protein sequence
Red=Cloning site Green=Tags(s) MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQR LGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEE PSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMAKEGQLYAM ELQGFWMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVV EDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIG ESVPEPRIIM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068806 |
Locus ID | 29925 |
UniProt ID | Q9Y5P6 |
Refseq Size | 1607 |
Cytogenetics | 3p21.31 |
Refseq ORF | 1080 |
Synonyms | LGMDR19; MDDGA14; MDDGB14; MDDGC14 |
Summary | This gene is thought to encode a GDP-mannose pyrophosphorylase. The encoded protein catalyzes the conversion of mannose-1-phosphate and GTP to GDP-mannose, a reaction involved in the production of N-linked oligosaccharides. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2009] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411846 | GMPPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415640 | GMPPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411846 | Transient overexpression lysate of GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2 |
CNY 3,080.00 |
|
LY415640 | Transient overexpression lysate of GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1 |
CNY 3,080.00 |
|
PH300186 | GMPPB MS Standard C13 and N15-labeled recombinant protein (NP_068806) |
CNY 19,520.00 |