DUSP23 (NM_017823) Human Recombinant Protein
CAT#: TP300171
Recombinant protein of human dual specificity phosphatase 23 (DUSP23), 20 µg
View other "DUSP23" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200171 protein sequence
Red=Cloning site Green=Tags(s) MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK AVFQFYQRTK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060293 |
Locus ID | 54935 |
UniProt ID | Q9BVJ7 |
Refseq Size | 718 |
Cytogenetics | 1q23.2 |
Refseq ORF | 450 |
Synonyms | DUSP25; LDP-3; LDP3; MOSP; VHZ |
Summary | Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402621 | DUSP23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402621 | Transient overexpression lysate of dual specificity phosphatase 23 (DUSP23) |
CNY 3,080.00 |
|
PH300171 | DUSP23 MS Standard C13 and N15-labeled recombinant protein (NP_060293) |
CNY 19,520.00 |