CFAP298 (NM_021254) Human Recombinant Protein
CAT#: TP300169
Recombinant protein of human chromosome 21 open reading frame 59 (C21orf59), 20 µg
View other "CFAP298" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200169 protein sequence
Red=Cloning site Green=Tags(s) MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQI EELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVK DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGK NEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFH GVKDIKWRPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067077 |
Locus ID | 56683 |
UniProt ID | P57076 |
Refseq Size | 1427 |
Cytogenetics | 21q22.11 |
Refseq ORF | 870 |
Synonyms | C21orf48; C21orf59; CILD26; FBB18; Kur |
Summary | This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene. [provided by RefSeq, Apr 2017] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Antibody-based Protein Profiling of the Human Chromosome 21
,Mathias Uhlén, Per Oksvold, Cajsa Älgenäs, Carl Hamsten, Linn Fagerberg, Daniel Klevebring, Emma Lundberg, Jacob Odeberg, Fredrik Pontén, Tadashi Kondo, and Åsa Sivertsson,
Mol. Cell. Proteomics, Mar 2012; 11: M111.013458.
[CFAP298]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402864 | C21orf59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402864 | Transient overexpression lysate of chromosome 21 open reading frame 59 (C21orf59) |
CNY 3,080.00 |
|
PH300169 | C21orf59 MS Standard C13 and N15-labeled recombinant protein (NP_067077) |
CNY 19,520.00 |
其它CFAP298产品