GMEB1 (NM_024482) Human Recombinant Protein
CAT#: TP300152
Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 2, 20 µg
View other "GMEB1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200152 protein sequence
Red=Cloning site Green=Tags(s) MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGIYEAGSENNTAVVAVETHTIHKIEEGI DTGTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGKSTLKDWKRAIR LGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSARAPVPGQQTSVVQTPTSADGSITQIAISEE SMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQR LIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKS QTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQG SSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTTMVSPVELVAM ESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEIVV LED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077808 |
Locus ID | 10691 |
UniProt ID | Q9Y692, B1AT47 |
Refseq Size | 2661 |
Cytogenetics | 1p35.3 |
Refseq ORF | 1689 |
Synonyms | P96PIF; PIF96 |
Summary | This gene encodes a member of KDWK gene family which associates with GMEB2 protein. The GMEB1-GMEB2 complex is essential for parvovirus DNA replication. Studies in rat for a similar gene suggest that this gene's role is to modulate the transactivation of the glucocorticoid receptor when it is bound to glucocorticoid response elements. Three alternative spliced transcript variants encoding different isoforms exist. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411280 | GMEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411280 | Transient overexpression lysate of glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 2 |
CNY 3,080.00 |
|
PH300152 | GMEB1 MS Standard C13 and N15-labeled recombinant protein (NP_077808) |
CNY 19,520.00 |
|
PH317117 | GMEB1 MS Standard C13 and N15-labeled recombinant protein (NP_006573) |
CNY 19,520.00 |
|
TP317117 | Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP710006 | Recombinant protein of human glucocorticoid modulatory element binding protein 1 (GMEB1), full length, with C-terminal polyhistidine tag,expressed in sf9 cells |
CNY 4,020.00 |