REC8 (NM_005132) Human Recombinant Protein
CAT#: TP300132
Recombinant protein of human REC8 homolog (yeast) (REC8), transcript variant 1, 20 µg
View other "REC8" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200132 protein sequence
Red=Cloning site Green=Tags(s) MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGLPRPRFSLYLS AQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPNHLAMMETLEDAPDPFFGMM SVDPRLPSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGE RELPEVSRRELDLLIAEEEEAILLEIPRLPPPAPAEVEGIGEALGPEELRLTGWEPGALLMEVTPPEELR LPAPPSPERRPPVPPPPRRRRRRRLLFWDKETQISPEKFQEQLQTRAHCWECPMVQPPERTIRGPAELFR TPTLSGWLPPELLGLWTHCAQPPPKALRRELPEEAAAEEERRKIEVPSEIEVPREALEPSVPLMVSLEIS LEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALEL QANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005123 |
Locus ID | 9985 |
UniProt ID | O95072 |
Refseq Size | 2253 |
Cytogenetics | 14q12 |
Refseq ORF | 1641 |
Synonyms | HR21spB; REC8L1; Rec8p |
Summary | This gene encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Oocyte meiosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401575 | REC8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420781 | REC8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401575 | Transient overexpression lysate of REC8 homolog (yeast) (REC8), transcript variant 1 |
CNY 3,080.00 |
|
LY420781 | Transient overexpression lysate of REC8 homolog (yeast) (REC8), transcript variant 2 |
CNY 4,840.00 |
|
PH300132 | REC8 MS Standard C13 and N15-labeled recombinant protein (NP_005123) |
CNY 19,520.00 |