NANS (NM_018946) Human Recombinant Protein
CAT#: TP300123
Recombinant protein of human N-acetylneuraminic acid synthase (NANS), 20 µg
View other "NANS" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200123 protein sequence
Red=Cloning site Green=Tags(s) MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERP YTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNF PYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDI PIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELV DNHGKKIKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061819 |
Locus ID | 54187 |
UniProt ID | Q9NR45 |
Refseq Size | 1257 |
Cytogenetics | 9q22.33 |
Refseq ORF | 1077 |
Synonyms | HEL-S-100; SAS; SEMDCG; SEMDG |
Summary | This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. [provided by RefSeq, Jul 2008] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
N-Acetylneuraminic Acid Synthase (NANS)
,Betenbaugh, MJ;Yin, B;Blake, E;Kristoffersen, L;,
Handbook of Glycosyltransferases and Related Genes, Feb 2014.
[NANS]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412808 | NANS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412808 | Transient overexpression lysate of N-acetylneuraminic acid synthase (NANS) |
CNY 3,080.00 |
|
PH300123 | NANS MS Standard C13 and N15-labeled recombinant protein (NP_061819) |
CNY 19,520.00 |
|
TP720942 | Purified recombinant protein of Human N-acetylneuraminic acid synthase (NANS) |
CNY 3,140.00 |