METTL11A (NTMT1) (NM_014064) Human Recombinant Protein
CAT#: TP300055
Recombinant protein of human methyltransferase like 11A (METTL11A), 20 µg
View other "METTL11A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200055 protein sequence
Red=Cloning site Green=Tags(s) MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA GIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGH LTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENL PDEIYHVYSFALR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054783 |
Locus ID | 28989 |
UniProt ID | Q9BV86, A0A024R8E4 |
Refseq Size | 1536 |
Cytogenetics | 9q34.11 |
Refseq ORF | 669 |
Synonyms | AD-003; C9orf32; HOMT1A; METTL11A; NRMT; NRMT1; NTM1A |
Summary | The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 600960) and RB (MIM 180200).[supplied by OMIM, Nov 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415489 | NTMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415489 | Transient overexpression lysate of methyltransferase like 11A (METTL11A) |
CNY 3,080.00 |
|
PH300055 | METTL11A MS Standard C13 and N15-labeled recombinant protein (NP_054783) |
CNY 19,520.00 |
其它METTL11A产品