Tropomodulin 2 (TMOD2) (NM_001142885) Human Mass Spec Standard
CAT#: PH327766
TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001136357)
View other "Tropomodulin 2" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
Specifications
Product Data | |
Description | TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001136357) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227766 |
Predicted MW | 35.5 kDa |
Protein Sequence |
>RC227766 representing NM_001142885
Red=Cloning site Green=Tags(s) MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLL MYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGV HNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKAF ADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILK FGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001136357 |
RefSeq ORF | 945 |
Synonyms | N-TMOD; NTMOD |
Locus ID | 29767 |
Cytogenetics | 15q21.2 |
Summary | This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Dec 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415226 | TMOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428294 | TMOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY415226 | Transient overexpression lysate of tropomodulin 2 (neuronal) (TMOD2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY428294 | Transient overexpression lysate of tropomodulin 2 (neuronal) (TMOD2), transcript variant 2 |
CN¥ 3,080.00 |
|
PH309053 | TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_055363) |
CN¥ 19,520.00 |
|
TP309053 | Recombinant protein of human tropomodulin 2 (neuronal) (TMOD2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP327766 | Purified recombinant protein of Homo sapiens tropomodulin 2 (neuronal) (TMOD2), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
其它Tropomodulin 2产品