ECSIT (NM_001142465) Human Mass Spec Standard
CAT#: PH327595
ECSIT MS Standard C13 and N15-labeled recombinant protein (NP_001135937)
View other "ECSIT" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ECSIT MS Standard C13 and N15-labeled recombinant protein (NP_001135937) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227595 |
Predicted MW | 24 kDa |
Protein Sequence |
>RC227595 representing NM_001142465
Red=Cloning site Green=Tags(s) MSWVQATLLARGLCRAWGGTCGAALTGTSISQVPLPKDSTGAADPPQPHIVGIQSPDQQAALARHNPARP VFVEGPFSLWLRNKCVYYHILRADLLPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINEVEEG PVFAMCMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEEPPLPEDHQEEDDNLQ RQQQGQS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001135937 |
RefSeq ORF | 651 |
Synonyms | SITPEC |
Locus ID | 51295 |
Cytogenetics | 19p13.2 |
Summary | Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428111 | ECSIT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY428111 | Transient overexpression lysate of ECSIT homolog (Drosophila) (ECSIT), transcript variant 3 |
CNY 3,080.00 |
|
TP327595 | Recombinant protein of human ECSIT homolog (Drosophila) (ECSIT), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP761122 | Purified recombinant protein of Human ECSIT homolog (Drosophila) (ECSIT), nuclear gene encoding mitochondrial protein, transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |