United States
Germany
Japan
United Kingdom
China
FCGRT (NM_001136019) Human Mass Spec Standard
CAT＃: PH327329
FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491)
View other "FCGRT" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227329 |
| Predicted MW | 39.6 kDa |
| Protein Sequence |
>RC227329 representing NM_001136019
Red=Cloning site Green=Tags(s) MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA QDADLKDVNVIPATA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001129491 |
| RefSeq ORF | 1095 |
| Synonyms | alpha-chain; FCRN |
| Locus ID | 2217 |
| Cytogenetics | 19q13.33 |
| Summary | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401327 | FCGRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427768 | FCGRT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401327 | Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 |
CNY 3,080.00 |
|
| LY427768 | Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1 |
CNY 3,080.00 |
|
| PH300364 | FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_004098) |
CNY 19,520.00 |
|
| TP300364 | Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP327329 | Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP721216 | Purified recombinant protein of Human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 |
CNY 3,140.00 |
