United States
Germany
Japan
United Kingdom
China
Parvin gamma (PARVG) (NM_001137606) Human Mass Spec Standard
CAT＃: PH327051
PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131078)
View other "Parvin gamma" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131078) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227051 |
| Predicted MW | 37.5 kDa |
| Protein Sequence |
>RC227051 protein sequence
Red=Cloning site Green=Tags(s) MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEE DMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTL HLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVN AVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALE LLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001131078 |
| RefSeq Size | 1991 |
| RefSeq ORF | 993 |
| Synonyms | AI413459; gamma-parvin; OTTMUSP00000032048; parvin, gamma |
| Locus ID | 64098 |
| Cytogenetics | 22q13.31 |
| Summary | Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM, Aug 2004] |
| Protein Pathways | Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411746 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427944 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427945 | PARVG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411746 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 1 |
CNY 3,080.00 |
|
| LY427944 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 2 |
CNY 3,080.00 |
|
| LY427945 | Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 3 |
CNY 3,080.00 |
|
| PH306755 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_071424) |
CNY 19,520.00 |
|
| PH326988 | PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131077) |
CNY 19,520.00 |
|
| TP306755 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326988 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP327051 | Recombinant protein of human parvin, gamma (PARVG), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Parvin gamma产品
