GPR56 (ADGRG1) (NM_001145771) Human Mass Spec Standard
CAT#: PH326861
GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_001139243)
View other "GPR56" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_001139243) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226861 |
Predicted MW | 77.7 kDa |
Protein Sequence |
>RC226861 protein sequence
Red=Cloning site Green=Tags(s) MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAP FPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSV TSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQ SLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGR SGEAEKRLLLVDFSSQALFQDKNSSHVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWV EDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCL SWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPS MCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSF ASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001139243 |
RefSeq Size | 4269 |
RefSeq ORF | 2079 |
Synonyms | BFPP; BPPR; GPR56; TM7LN4; TM7XN1 |
Locus ID | 9289 |
Cytogenetics | 16q21 |
Summary | This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401733 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404437 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428998 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401733 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 1 |
CNY 3,080.00 |
|
LY404437 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 2 |
CNY 4,840.00 |
|
LY428998 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 4 |
CNY 4,840.00 |
|
PH300315 | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_005673) |
CNY 19,520.00 |
|
PH318780 | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_958932) |
CNY 19,520.00 |
|
TP300315 | Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP318780 | Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP326861 | Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 4, 20 µg |
CNY 2,900.00 |