Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Mass Spec Standard
CAT#: PH326807
GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_001137153)
View other "Glutathione S Transferase kappa 1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_001137153) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226807 |
Predicted MW | 20.4 kDa |
Protein Sequence |
>RC226807 representing NM_001143681
Red=Cloning site Green=Tags(s) MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGSLSAMRFLTAVNLEHPEM LEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGL PITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001137153 |
RefSeq ORF | 549 |
Synonyms | GST; GST13; GST 13-13; GST13-13; GSTK1-1; hGSTK1 |
Locus ID | 373156 |
Cytogenetics | 7q34 |
Summary | This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009] |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414320 | GSTK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428317 | GSTK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414320 | Transient overexpression lysate of glutathione S-transferase kappa 1 (GSTK1), transcript variant 1 |
CNY 3,080.00 |
|
LY428317 | Transient overexpression lysate of glutathione S-transferase kappa 1 (GSTK1), transcript variant 4 |
CNY 3,080.00 |
|
PH301467 | GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_057001) |
CNY 19,520.00 |
|
TP301467 | Recombinant protein of human glutathione S-transferase kappa 1 (GSTK1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326807 | Purified recombinant protein of Homo sapiens glutathione S-transferase kappa 1 (GSTK1), transcript variant 4, 20 µg |
CNY 2,900.00 |
其它Glutathione S Transferase kappa 1产品