TSH Receptor (TSHR) (NM_001142626) Human Mass Spec Standard
CAT#: PH326653
TSHR MS Standard C13 and N15-labeled recombinant protein (NP_001136098)
View other "TSH Receptor" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | TSHR MS Standard C13 and N15-labeled recombinant protein (NP_001136098) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226653 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC226653 representing NM_001142626
Red=Cloning site Green=Tags(s) MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH AFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKN KYLTVIDKDAFGGVYSGPSLLVENVAVSGKGFCKSLFSWLYRLPLGRKSLSFETQKAPRSSMPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001136098 |
RefSeq ORF | 822 |
Synonyms | CHNG1; hTSHR-I; LGR3 |
Locus ID | 7253 |
Cytogenetics | 14q31.1 |
Summary | The protein encoded by this gene is a membrane protein and a major controller of thyroid cell metabolism. The encoded protein is a receptor for thyrothropin and thyrostimulin, and its activity is mediated by adenylate cyclase. Defects in this gene are a cause of several types of hyperthyroidism. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Autoimmune thyroid disease, Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400133 | TSHR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400133 | Transient overexpression lysate of thyroid stimulating hormone receptor (TSHR), transcript variant 1 |
CNY 4,840.00 |
|
TP326653 | Purified recombinant protein of Homo sapiens thyroid stimulating hormone receptor (TSHR), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP701226 | Purified recombinant protein of Human thyroid stimulating hormone receptor (TSHR), transcript variant 1, Met22-Gly413, with C-terminal Human FC-AVI plus and His tag, expressed in CHO cells, 50ug |
CNY 7,820.00 |
其它TSH Receptor产品