Estrogen Receptor 1 (ESR1) (NM_001122741) Human Mass Spec Standard
CAT#: PH326004
ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_001116213)
View other "Estrogen Receptor 1" proteins (14)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_001116213) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226004 |
Predicted MW | 66 kDa |
Protein Sequence |
>RC226004 representing NM_001122741
Red=Cloning site Green=Tags(s) MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT VREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK RSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV GSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM AKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001116213 |
RefSeq ORF | 1785 |
Synonyms | ER; Era; ESR; ESRA; ESTRR; NR3A1 |
Locus ID | 2099 |
Cytogenetics | 6q25.1-q25.2 |
Summary | This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400046 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC426553 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426554 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426555 | ESR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400046 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 1 |
CNY 4,840.00 |
|
LY426553 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 2 |
CNY 3,080.00 |
|
LY426554 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 3 |
CNY 3,080.00 |
|
LY426555 | Transient overexpression lysate of estrogen receptor 1 (ESR1), transcript variant 4 |
CNY 3,080.00 |
|
PH313277 | ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_000116) |
CNY 19,520.00 |
|
PH326003 | ESR1 MS Standard C13 and N15-labeled recombinant protein (NP_001116212) |
CNY 14,250.00 |
|
TP313277 | Recombinant protein of human estrogen receptor 1 (ESR1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP326003 | Purified recombinant protein of Homo sapiens estrogen receptor 1 (ESR1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP326004 | Purified recombinant protein of Homo sapiens estrogen receptor 1 (ESR1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720514 | Recombinant protein of human estrogen receptor 1 (ESR1), transcript variant 1 |
CNY 3,140.00 |
其它Estrogen Receptor 1产品