CAP1 (NM_001105530) Human Mass Spec Standard
CAT#: PH325806
CAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001099000)
View other "CAP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001099000) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225806 |
Predicted MW | 51.7 kDa |
Protein Sequence |
>RC225806 protein sequence
Red=Cloning site Green=Tags(s) MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQ KHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQA LGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKT GPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRSALFAQINQGESITHALKHVSDDMKT HKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQV AYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001099000 |
RefSeq Size | 2780 |
RefSeq ORF | 1425 |
Synonyms | CAP; CAP1-PEN |
Locus ID | 10487 |
Cytogenetics | 1p34.2 |
Summary | The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401914 | CAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426252 | CAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401914 | Transient overexpression lysate of CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 1 |
CNY 3,080.00 |
|
LY426252 | Transient overexpression lysate of CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 2 |
CNY 3,080.00 |
|
PH301394 | CAP1 MS Standard C13 and N15-labeled recombinant protein (NP_006358) |
CNY 19,520.00 |
|
TP301394 | Recombinant protein of human CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325806 | Purified recombinant protein of Homo sapiens CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 2, 20 µg |
CNY 2,900.00 |