Neuro D4 (DPF1) (NM_001135155) Human Mass Spec Standard
CAT#: PH325651
DPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001128627)
View other "Neuro D4" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001128627) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225651 |
Predicted MW | 46.6 kDa |
Protein Sequence |
>RC225651 representing NM_001135155
Red=Cloning site Green=Tags(s) MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDS QTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPE GPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQ DTASLEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNNHKQFYKELAWVPE AQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCI ECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASAYITLT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001128627 |
RefSeq ORF | 1242 |
Synonyms | BAF45b; NEUD4; neuro-d4 |
Locus ID | 8193 |
Cytogenetics | 19q13.2 |
Summary | May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427564 | DPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432205 | DPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427564 | Transient overexpression lysate of D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 1 |
CNY 3,080.00 |
|
LY432205 | Transient overexpression lysate of D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 2 |
CNY 3,080.00 |
|
TP325651 | Recombinant protein of human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Neuro D4产品