RRAD (NM_001128850) Human Mass Spec Standard
CAT#: PH325433
RRAD MS Standard C13 and N15-labeled recombinant protein (NP_001122322)
View other "RRAD" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RRAD MS Standard C13 and N15-labeled recombinant protein (NP_001122322) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225433 |
Predicted MW | 33.1 kDa |
Protein Sequence |
>RC225433 representing NM_001128850
Red=Cloning site Green=Tags(s) MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRL DWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASL MVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRS REVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKR FLGRIVARNSRKMAFRAKSKSCHDLSVL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001122322 |
RefSeq ORF | 924 |
Synonyms | RAD; RAD1; REM3 |
Locus ID | 6236 |
Cytogenetics | 16q22.1 |
Summary | May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane (By similarity). Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418172 | RRAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427008 | RRAD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418172 | Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 2 |
CNY 3,080.00 |
|
LY427008 | Transient overexpression lysate of Ras-related associated with diabetes (RRAD), transcript variant 1 |
CNY 3,080.00 |
|
PH302927 | RRAD MS Standard C13 and N15-labeled recombinant protein (NP_004156) |
CNY 19,520.00 |
|
TP302927 | Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325433 | Recombinant protein of human Ras-related associated with diabetes (RRAD), transcript variant 1, 20 µg |
CNY 2,900.00 |