ASPDH (NM_001114598) Human Mass Spec Standard
CAT#: PH325390
ASPDH MS Standard C13 and N15-labeled recombinant protein (NP_001108070)
View other "ASPDH" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
Specifications
Product Data | |
Description | ASPDH MS Standard C13 and N15-labeled recombinant protein (NP_001108070) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225390 |
Predicted MW | 29.8 kDa |
Protein Sequence |
>RC225390 representing NM_001114598
Red=Cloning site Green=Tags(s) MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDL VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAA GGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVI GVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGI HLC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001108070 |
RefSeq ORF | 849 |
Locus ID | 554235 |
Cytogenetics | 19q13.33 |
Summary | Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422526 | ASPDH HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426491 | ASPDH HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY422526 | Transient overexpression lysate of aspartate dehydrogenase domain containing (ASPDH), transcript variant 2 |
CN¥ 3,080.00 |
|
LY426491 | Transient overexpression lysate of aspartate dehydrogenase domain containing (ASPDH), transcript variant 1 |
CN¥ 3,080.00 |
|
TP325390 | Recombinant protein of human aspartate dehydrogenase domain containing (ASPDH), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP760231 | Recombinant protein of human aspartate dehydrogenase domain containing (ASPDH), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |
|
TP760327 | Purified recombinant protein of Homo sapiens aspartate dehydrogenase domain containing (ASPDH), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |