C7orf46 (FAM221A) (NM_001127364) Human Mass Spec Standard
CAT#: PH325356
C7orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001120836)
View other "C7orf46" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 3,080.00
Specifications
Product Data | |
Description | C7orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001120836) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225356 |
Predicted MW | 29.2 kDa |
Protein Sequence |
>RC225356 representing NM_001127364
Red=Cloning site Green=Tags(s) MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVG PETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFT CNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDS GIVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001120836 |
RefSeq ORF | 786 |
Synonyms | C7orf46 |
Locus ID | 340277 |
Cytogenetics | 7p15.3 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404748 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426758 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426759 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404748 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 1 |
CNY 3,080.00 |
|
LY426758 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 2 |
CNY 3,080.00 |
|
LY426759 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 3 |
CNY 3,080.00 |
|
TP325356 | Recombinant protein of human chromosome 7 open reading frame 46 (C7orf46), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760985 | Purified recombinant protein of Human chromosome 7 open reading frame 46 (C7orf46), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它C7orf46产品