United States
Germany
Japan
United Kingdom
China
C7orf46 (FAM221A) (NM_001127364) Human Recombinant Protein
CAT＃: TP325356
Recombinant protein of human chromosome 7 open reading frame 46 (C7orf46), transcript variant 2, 20 µg
View other "C7orf46" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225356 representing NM_001127364
Red=Cloning site Green=Tags(s) MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVG PETLCFCTHRYKQHKTDLEAIPQQCPIDLPCQVTGCQCRAYLYVPLNGSQPIRCRCKHFADQHSAAPGFT CNTCSKCSGFHSCFTCACGQPAYAHDTVVETKQERLAQEKPVGQDIPYAAMGGLTGFSSLAEGYMRLDDS GIVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATKPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001120836 |
| Locus ID | 340277 |
| UniProt ID | A4D161 |
| Cytogenetics | 7p15.3 |
| Refseq ORF | 786 |
| Synonyms | C7orf46 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404748 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426758 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426759 | FAM221A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404748 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 1 |
CNY 3,080.00 |
|
| LY426758 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 2 |
CNY 3,080.00 |
|
| LY426759 | Transient overexpression lysate of chromosome 7 open reading frame 46 (C7orf46), transcript variant 3 |
CNY 3,080.00 |
|
| PH325356 | C7orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001120836) |
CNY 14,250.00 |
|
| TP760985 | Purified recombinant protein of Human chromosome 7 open reading frame 46 (C7orf46), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它C7orf46产品
