United States
Germany
Japan
United Kingdom
China
YPEL5 (NM_001127401) Human Mass Spec Standard
CAT＃: PH325061
YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120873)
View other "YPEL5" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120873) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225061 |
| Predicted MW | 13.8 kDa |
| Protein Sequence |
>RC225061 protein sequence
Red=Cloning site Green=Tags(s) MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRD VSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001120873 |
| RefSeq Size | 2639 |
| RefSeq ORF | 363 |
| Synonyms | CGI-127 |
| Locus ID | 51646 |
| Cytogenetics | 2p23.1 |
| Summary | Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (PubMed:29911972). Required for normal cell proliferation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402494 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426781 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426782 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426783 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402494 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 4 |
CNY 3,080.00 |
|
| LY426781 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 3 |
CNY 3,080.00 |
|
| LY426782 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 2 |
CNY 3,080.00 |
|
| LY426783 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 1 |
CNY 3,080.00 |
|
| PH301463 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_057145) |
CNY 14,250.00 |
|
| PH325059 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120871) |
CNY 14,250.00 |
|
| PH325060 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120872) |
CNY 14,250.00 |
|
| TP301463 | Recombinant protein of human yippee-like 5 (Drosophila) (YPEL5), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP325059 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP325060 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP325061 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 1, 20 µg |
CNY 2,900.00 |
