YPEL5 (NM_001127399) Human Mass Spec Standard
CAT#: PH325059
YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120871)
View other "YPEL5" proteins (15)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120871) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225059 |
Predicted MW | 13.8 kDa |
Protein Sequence |
>RC225059 protein sequence
Red=Cloning site Green=Tags(s) MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRD VSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001120871 |
RefSeq Size | 2342 |
RefSeq ORF | 363 |
Synonyms | CGI-127 |
Locus ID | 51646 |
Cytogenetics | 2p23.1 |
Summary | Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (PubMed:29911972). Required for normal cell proliferation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402494 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426781 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426782 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426783 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402494 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 4 |
CNY 3,080.00 |
|
LY426781 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 3 |
CNY 3,080.00 |
|
LY426782 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 2 |
CNY 3,080.00 |
|
LY426783 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 1 |
CNY 3,080.00 |
|
PH301463 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_057145) |
CNY 14,250.00 |
|
PH325060 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120872) |
CNY 14,250.00 |
|
PH325061 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120873) |
CNY 14,250.00 |
|
TP301463 | Recombinant protein of human yippee-like 5 (Drosophila) (YPEL5), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP325059 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP325060 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325061 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 1, 20 µg |
CNY 2,900.00 |