SSX3 (NM_021014) Human Mass Spec Standard
CAT#: PH324933
SSX3 MS Standard C13 and N15-labeled recombinant protein (NP_066294)
View other "SSX3" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SSX3 MS Standard C13 and N15-labeled recombinant protein (NP_066294) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224933 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC224933 protein sequence
Red=Cloning site Green=Tags(s) MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSF MRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLC PPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066294 |
RefSeq Size | 1336 |
RefSeq ORF | 564 |
Synonyms | CT5.3 |
Locus ID | 10214 |
Cytogenetics | Xp11.23 |
Summary | The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. [provided by RefSeq, Jul 2013] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406259 | SSX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412140 | SSX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406259 | Transient overexpression lysate of synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 2 |
CNY 3,080.00 |
|
LY412140 | Transient overexpression lysate of synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 1 |
CNY 3,080.00 |
|
PH303244 | SSX3 MS Standard C13 and N15-labeled recombinant protein (NP_783642) |
CNY 19,520.00 |
|
TP303244 | Recombinant protein of human synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP324933 | Recombinant protein of human synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 1, 20 µg |
CNY 2,900.00 |