ERMAP (NM_018538) Human Mass Spec Standard
CAT#: PH324743
ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_061008)
View other "ERMAP" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_061008) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224743 |
Predicted MW | 52.6 kDa |
Protein Sequence |
>RC224743 protein sequence
Red=Cloning site Green=Tags(s) MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPF PQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVI LQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHK AVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVV SILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFR LKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE SIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061008 |
RefSeq Size | 3381 |
RefSeq ORF | 1425 |
Synonyms | BTN5; PRO2801; RD; SC |
Locus ID | 114625 |
Cytogenetics | 1p34.2 |
Summary | The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413005 | ERMAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422752 | ERMAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY413005 | Transient overexpression lysate of erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2 |
CNY 3,080.00 |
|
LY422752 | Transient overexpression lysate of erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 1 |
CNY 4,840.00 |
|
PH315022 | ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_001017922) |
CNY 19,520.00 |
|
TP315022 | Recombinant protein of human erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP324743 | Recombinant protein of human erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2, 20 µg |
CNY 2,900.00 |