PSMB8 (NM_148919) Human Mass Spec Standard
CAT#: PH324611
PSMB8 MS Standard C13 and N15-labeled recombinant protein (NP_683720)
View other "PSMB8" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | PSMB8 MS Standard C13 and N15-labeled recombinant protein (NP_683720) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224611 |
Predicted MW | 30.2 kDa |
Protein Sequence |
>RC224611 representing NM_148919
Red=Cloning site Green=Tags(s) MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGDGERNVQIEMA HGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYL RNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGV MDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_683720 |
RefSeq Size | 1135 |
RefSeq ORF | 828 |
Synonyms | ALDD; D6S216; D6S216E; JMP; LMP7; NKJO; PRAAS1; PSMB5i; RING10 |
Locus ID | 5696 |
Cytogenetics | 6p21.32 |
Summary | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407730 | PSMB8 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC418176 | PSMB8 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY407730 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 2 |
CN¥ 3,080.00 |
|
LY418176 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1 |
CN¥ 3,080.00 |
|
PH300353 | PSMB8 MS Standard C13 and N15-labeled recombinant protein (NP_004150) |
CN¥ 19,520.00 |
|
TP300353 | Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP324611 | Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 2, 20 µg |
CN¥ 2,900.00 |