SNX12 (NM_013346) Human Mass Spec Standard
CAT#: PH324303
SNX12 MS Standard C13 and N15-labeled recombinant protein (NP_037478)
View other "SNX12" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SNX12 MS Standard C13 and N15-labeled recombinant protein (NP_037478) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224303 |
Predicted MW | 18.9 kDa |
Protein Sequence |
>RC224303 protein sequence
Red=Cloning site Green=Tags(s) MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRR RYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNER CLHMFLQEEAIDRNYVPGKVRQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037478 |
RefSeq Size | 2416 |
RefSeq ORF | 486 |
Locus ID | 29934 |
Cytogenetics | Xq13.1 |
Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. A similar protein in mouse may be involved in regulating the neurite outgrowth. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415650 | SNX12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415650 | Transient overexpression lysate of sorting nexin 12 (SNX12) |
CNY 3,080.00 |
|
TP324303 | Recombinant protein of human sorting nexin 12 (SNX12), 20 µg |
CNY 2,900.00 |