RAC1 (NM_018890) Human Mass Spec Standard
CAT#: PH324262
RAC1 MS Standard C13 and N15-labeled recombinant protein (NP_061485)
View other "RAC1" proteins (8)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | RAC1 MS Standard C13 and N15-labeled recombinant protein (NP_061485) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224262 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC224262 representing NM_018890
Red=Cloning site Green=Tags(s) MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL SYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRD DKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLL L myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061485 |
RefSeq Size | 2412 |
RefSeq ORF | 633 |
Synonyms | MIG5; MRD48; p21-Rac1; Rac-1; TC-25 |
Locus ID | 5879 |
Cytogenetics | 7p22.1 |
Summary | The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Amyotrophic lateral sclerosis (ALS), Axon guidance, B cell receptor signaling pathway, Chemokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, Toll-like receptor signaling pathway, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412906 | RAC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC416329 | RAC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC429589 | RAC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY412906 | Transient overexpression lysate of ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1b |
CN¥ 3,080.00 |
|
LY416329 | Transient overexpression lysate of ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1 |
CN¥ 3,080.00 |
|
PH308711 | RAC1 MS Standard C13 and N15-labeled recombinant protein (NP_008839) |
CN¥ 19,520.00 |
|
TP308711 | Recombinant protein of human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1, 20 µg |
CN¥ 2,900.00 |
|
TP324262 | Recombinant protein of human ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), transcript variant Rac1b, 20 µg |
CN¥ 2,900.00 |