ACOT7 (NM_181866) Human Mass Spec Standard
CAT#: PH324159
ACOT7 MS Standard C13 and N15-labeled recombinant protein (NP_863656)
View other "ACOT7" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ACOT7 MS Standard C13 and N15-labeled recombinant protein (NP_863656) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224159 |
Predicted MW | 36.4 kDa |
Protein Sequence |
>RC224159 representing NM_181866
Red=Cloning site Green=Tags(s) MAFQLSRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGEV AHVSAEITYTSKHSVEVQVNVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVVYSRQEQEEEGR KRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIV AARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDSSQKRYRAASAFFT YVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHAEPQP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_863656 |
RefSeq Size | 1376 |
RefSeq ORF | 987 |
Synonyms | ACH1; ACT; BACH; CTE-II; hBACH; LACH; LACH1 |
Locus ID | 11332 |
Cytogenetics | 1p36.31 |
Summary | This gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester of palmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesial temporal lobe epilepsy. Alternatively spliced transcript variants encoding distinct isoforms with different subcellular locations have been characterized. [provided by RefSeq, Jul 2008] |
Protein Pathways | Biosynthesis of unsaturated fatty acids |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405559 | ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405560 | ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405561 | ACOT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405559 | Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHb |
CNY 3,080.00 |
|
LY405560 | Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHc |
CNY 3,080.00 |
|
LY405561 | Transient overexpression lysate of acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHd |
CNY 3,080.00 |
|
TP324159 | Recombinant protein of human acyl-CoA thioesterase 7 (ACOT7), transcript variant hBACHd, 20 µg |
CNY 2,900.00 |