United States
Germany
Japan
United Kingdom
China
HIP55 (DBNL) (NM_001014436) Human Mass Spec Standard
CAT＃: PH323992
DBNL MS Standard C13 and N15-labeled recombinant protein (NP_001014436)
View other "HIP55" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | DBNL MS Standard C13 and N15-labeled recombinant protein (NP_001014436) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223992 |
| Predicted MW | 48.3 kDa |
| Protein Sequence |
>RC223992 protein sequence
Red=Cloning site Green=Tags(s) MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR ERELREAARREQRYQEQGGEASPQSRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPG KLRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPL VQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFG MFPANYVELIE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001014436 |
| RefSeq Size | 2210 |
| RefSeq ORF | 1293 |
| Synonyms | ABP1; HIP-55; HIP55; SH3P7 |
| Locus ID | 28988 |
| Cytogenetics | 7p13 |
| Summary | Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and synapse formation via its interaction with WASL and COBL. Does not bind G-actin and promote actin polymerization by itself. Required for the formation of organized podosome rosettes (By similarity). May act as a common effector of antigen receptor-signaling pathways in leukocytes. Acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402274 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423061 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC426586 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402274 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 1 |
CNY 3,080.00 |
|
| LY423061 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 2 |
CNY 4,840.00 |
|
| LY426586 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 3 |
CNY 3,080.00 |
|
| PH303435 | DBNL MS Standard C13 and N15-labeled recombinant protein (NP_054782) |
CNY 19,520.00 |
|
| TP303435 | Recombinant protein of human drebrin-like (DBNL), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP323992 | Recombinant protein of human drebrin-like (DBNL), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP710145 | Recombinant protein of human drebrin-like (DBNL), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
