RUNX1 (NM_001001890) Human Mass Spec Standard
CAT#: PH323854
RUNX1 MS Standard C13 and N15-labeled recombinant protein (NP_001001890)
View other "RUNX1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | RUNX1 MS Standard C13 and N15-labeled recombinant protein (NP_001001890) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223854 |
Predicted MW | 48.6 kDa |
Protein Sequence |
>RC223854 representing NM_001001890
Red=Cloning site Green=Tags(s) MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRA SGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001001890 |
RefSeq Size | 7288 |
RefSeq ORF | 1359 |
Synonyms | AML1; AML1-EVI-1; AMLCR1; CBF2alpha; CBFA2; EVI-1; PEBP2aB; PEBP2alpha |
Locus ID | 861 |
Cytogenetics | 21q22.12 |
Summary | Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Chronic myeloid leukemia, Pathways in cancer |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Hyperglycemia and redox status regulate RUNX2 DNA-binding and an angiogenic phenotype in endothelial cells
,null,
Microvascular research
,PubMed ID 25283348
[RUNX1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419764 | RUNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424261 | RUNX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY419764 | Transient overexpression lysate of runt-related transcription factor 1 (RUNX1), transcript variant 1 |
CNY 4,840.00 |
|
LY424261 | Transient overexpression lysate of runt-related transcription factor 1 (RUNX1), transcript variant 2 |
CNY 4,840.00 |
|
TP323854 | Recombinant protein of human runt-related transcription factor 1 (RUNX1), transcript variant 2, 20 µg |
CNY 2,900.00 |