AKAP7 (NM_138633) Human Mass Spec Standard
CAT#: PH323812
AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_619539)
View other "AKAP7" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_619539) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223812 |
Predicted MW | 11.3 kDa |
Protein Sequence |
>RC223812 representing NM_138633
Red=Cloning site Green=Tags(s) MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQ YLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_619539 |
RefSeq Size | 2348 |
RefSeq ORF | 312 |
Synonyms | AKAP15; AKAP18 |
Locus ID | 9465 |
Cytogenetics | 6q23.2 |
Summary | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413981 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417708 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429496 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413981 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma |
CNY 3,080.00 |
|
LY417708 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha |
CNY 3,080.00 |
|
LY429496 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma |
CNY 3,080.00 |
|
PH313040 | AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833) |
CNY 19,520.00 |
|
TP313040 | Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha, 20 µg |
CNY 2,900.00 |
|
TP323812 | Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta, 20 µg |
CNY 2,900.00 |
|
TP760674 | Purified recombinant protein of Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |