United States
Germany
Japan
United Kingdom
China
AKAP7 (NM_004842) Human Mass Spec Standard
CAT＃: PH313040
AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833)
View other "AKAP7" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213040 |
| Predicted MW | 8.8 kDa |
| Protein Sequence |
>RC213040 representing NM_004842
Red=Cloning site Green=Tags(s) MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAAD QNGNDNENNRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004833 |
| RefSeq Size | 2279 |
| RefSeq ORF | 243 |
| Synonyms | AKAP15; AKAP18 |
| Locus ID | 9465 |
| Cytogenetics | 6q23.2 |
| Summary | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413981 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417708 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429496 | AKAP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413981 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma |
CNY 3,080.00 |
|
| LY417708 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha |
CNY 3,080.00 |
|
| LY429496 | Transient overexpression lysate of A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma |
CNY 3,080.00 |
|
| PH323812 | AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_619539) |
CNY 19,520.00 |
|
| TP313040 | Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha, 20 µg |
CNY 2,900.00 |
|
| TP323812 | Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta, 20 µg |
CNY 2,900.00 |
|
| TP760674 | Purified recombinant protein of Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant gamma, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
