FADS2 (NM_004265) Human Mass Spec Standard
CAT#: PH323780
FADS2 MS Standard C13 and N15-labeled recombinant protein (NP_004256)
View other "FADS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | FADS2 MS Standard C13 and N15-labeled recombinant protein (NP_004256) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223780 |
Predicted MW | 52.1 kDa |
Protein Sequence |
>RC223780 representing NM_004265
Red=Cloning site Green=Tags(s) MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATD AFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHI IALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASA NWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQ YQIIMTMIVHKNWVDLAWAVSYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQE AYRDWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALLDIIRSLKKSGKLWLDAYLHK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004256 |
RefSeq Size | 3149 |
RefSeq ORF | 1332 |
Synonyms | D6D; DES6; FADSD6; LLCDL2; SLL0262; TU13 |
Locus ID | 9415 |
Cytogenetics | 11q12.2 |
Summary | The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Transmembrane |
Protein Pathways | alpha-Linolenic acid metabolism, Biosynthesis of unsaturated fatty acids, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418107 | FADS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY418107 | Transient overexpression lysate of fatty acid desaturase 2 (FADS2) |
CNY 4,840.00 |
|
TP323780 | Recombinant protein of human fatty acid desaturase 2 (FADS2), 20 µg |
CNY 2,900.00 |