United States
Germany
Japan
United Kingdom
China
LRSAM1 (NM_001005374) Human Mass Spec Standard
CAT＃: PH323778
LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005374)
View other "LRSAM1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005374) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223778 |
| Predicted MW | 83.6 kDa |
| Protein Sequence |
>RC223778 protein sequence
Red=Cloning site Green=Tags(s) MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVLIVHTNHLTSL LPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLPRSIGNLTQLQTLNVKDNKLK ELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSLDASAMVYPPREVCGAGTAAILQFLCKESGL EYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQRE HTQLLQQSSSQKDEILQTVKEEQSRLEQGLSEHQRHLDAERQRLQEQLKQTEQNISSRIQKLLQDNQRQK KSSEILKSLENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQIKLIETELLQLTQLEL KRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKSETRQENYWLIQYQRLLNQKP LSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILRRVQELL DAARIQPELKPPMGEVVTPTAPQEPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCC QPLRTCPLCRQDIAQRLRIYHSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001005374 |
| RefSeq Size | 2851 |
| RefSeq ORF | 2169 |
| Synonyms | CMT2P; RIFLE; TAL |
| Locus ID | 90678 |
| Cytogenetics | 9q33.3-q34.11 |
| Summary | This gene encodes a ring finger protein involved in a variety of functions, including regulation of signaling pathways and cell adhesion, mediation of self-ubiquitylation, and involvement in cargo sorting during receptor endocytosis. Mutations in this gene have been associated with Charcot-Marie-Tooth disease. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jan 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408632 | LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423706 | LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423707 | LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC434379 | LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY408632 | Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 1 |
CNY 3,080.00 |
|
| LY423706 | Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 2 |
CNY 3,080.00 |
|
| LY423707 | Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 3 |
CNY 4,840.00 |
|
| LY434379 | Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 4 |
CNY 4,840.00 |
|
| PH300920 | LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005373) |
CNY 19,520.00 |
|
| PH315025 | LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_612370) |
CNY 19,520.00 |
|
| TP300920 | Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP315025 | Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP323778 | Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 3, 20 µg |
CNY 2,900.00 |
